Business Network New York
Companies:51,220
Products and Services:2,875
Articles and publications:31,355 (+2)
Tenders & Vacancies:17

White Plains Family Dental
Information may not be reliable

#books white plain hotel ny airport car rental book club
AddressWhite Plains, NY 10605-
Phone(914) 289-0672
Websitewhiteplainsfamilydental.net

whiteplainsfamilydental.net may be for sale. Buy this domain!


Hotel Plain White
NY Plain White
Airport Plain White
Crowne Hotel Plain Plaza White
Car Plain Rental White
Inn Plain Residence White

Buy Book Online

Rating:

Related items:

Gold Coast Family Dental PLLC
Information may not be reliable
Gold Coast Family Dental is a group in Port Washington, NY who provides family, cosmetic, restorative, periodontic, and implant dentistry.
  • 2 Cow Neck Rd Port Washington, NY 11050-1712
  • (516) 883-4477
Parkview Family Dental, PC
Information may not be reliable
Parkview Family Dental PC, located in Pomona, NY provides the highest quality dental care with a gentle, caring touch.
  • 18 Thiells Mt Ivy Rd Suite 1 Pomona, NY 10970-3085
  • (845) 354-6444
Fairfield Family Dental
Information may not be reliable
Welcome to Fairfield Family Dental! We are proud to be your chosen Lancaster, OH dental home.
  • Lancaster, OH 43130-
  • (740) 653-1031
Family Dental RegO Park
Information may not be reliable
Family Dental Rego Park, Dr. Binod Verma and Dr. Supriya Verma are General Dentists practicing in Rego Park, NY 11373.
  • Elmhurst, NY 11373-
  • (718) 699-8268
Brighton Family Dental Group
Information may not be reliable
Brighton Family Dental provides general and specialty services from professionally trained hygienists and doctors and stresses the priority of
  • Tonawanda, NY 14150-
  • (716) 836-4590
×